Description
Article no.: T-518-10
|
Description |
Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. |
|
Amount |
1mg |
|
Format |
Lyophilized |
|
Molecular Weight |
13771 Da |
|
Sequence |
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSEPGELHGLTTEEEFVEGIYKV |
|
Purity |
95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Carbonate |
|
Solubility |
The lyophilized protein is readily soluble in PBS pH 7.4. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli. |