Description
Article no.: TAU-381-10
|
Description |
Tau aggregates are a defining hallmark of several neurodegenerative disorders collectively termed tauopathies, including Alzheimer’s disease and frontotemporal dementia, where intracellular inclusions are associated with progressive neuronal dysfunction and degeneration. |
|
Amount |
100 ug |
|
Format |
Lyophilized |
|
Molecular Weight |
39720.05 Da |
|
Sequence |
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAK |
|
Purity |
95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Carbonate |
|
Solubility |
The lyophilized protein is readily soluble in PBS pH 7.4. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli. |