Description
Article no.: AE-111-10
|
Description |
Apolipoprotein E is part of the chylomicron and Intermediate-density lipoproteins essential for the normal |
|
Amount |
1mg |
|
Format |
Lyophilized |
|
Molecular Weight |
34298.77 Da |
|
Sequence |
MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQ
|
|
Purity |
>95% by Chromatography and SDS-PAGE |
|
QC Data |
|
|
Counter Ion |
Ammonium Carbonate |
|
Solubility |
ApoE is soluble in PBS. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli. |