Apolipoprotein E2 (ApoE2) (1mg) 1-162 Human, Recombinant
$299
Apolipoprotein E is part of the chylomicron and Intermediate-density lipoproteins essential for the normal processing of triglyceride-rich lipoproteins. ApoE is primarily produced by the liver and macrophages. In the central nervous system, ApoE is mainly produced by astrocytes, and transports cholesterol to neurons via ApoE receptors.
Description
Article no.: AE-108-10
|
Amount |
1mg |
|
Format |
Lyophilized |
|
Molecular Weight |
19093.70 Da |
|
Sequence |
MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSS |
|
Purity |
95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Carbonate |
|
Solubility |
ApoE is soluble in PBS. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli. |