Description
Article no.: AE-120-10
|
Description |
Apolipoprotein E is part of the chylomicron and Intermediate-density lipoproteins essential for the normal processing of triglyceride-rich lipoproteins. ApoE is primarily produced by the liver and macrophages. In the central nervous system, ApoE is mainly produced by astrocytes and transports cholesterol to neurons via ApoE receptors. |
|
Amount |
1mg |
|
Format |
Lyophilized |
|
Molecular Weight |
15491.34 Da |
|
Sequence |
MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE |
|
Purity |
>95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Carbonate |
|
Solubility |
ApoE is soluble in PBS. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli. |