Description
Article no.: AB-301-10
|
Description |
Recombinant Amyloid-Beta peptide 4-40, Human |
|
Amount |
1mg |
|
Format |
Lyophilized |
|
Molecular Weight |
4015 Da |
|
Sequence |
FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
|
Purity |
95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Acetate |
|
Solubility |
Alexotech has developed a proprietary technique of preparing highly soluble Amyloid β-peptides. It is however, of utmost importance to follow our recommendations of solubilisation and to efficiently solubilise the Amyloid β-peptide. The pH should briefly be raised to between 11-12. This can be accomplished by addition of e.g. 20 mM NaOH, however, at higher peptide concentrations a higher concentration of NaOH may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using a 10X stock solution of the buffer of choice. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli. |