0
Your cart
Amyloid-Beta 1-40, 15N Uniform Label (0.5 mg) Human, Recombinant

Amyloid-Beta 1-40, 15N Uniform Label (0.5 mg) Human, Recombinant

$335
Read more...

    Description

    Article no.: ABN-100-05

    Description

    Recombinant Amyloid-Beta-Peptide (1-40) uniformly 15N labeled

    Amount

    0.5mg

    Format

    Lyophilized

    Sequence

    DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Purity

    95% by Chromatography and SDS-PAGE

    Counter Ion

    Ammonium Acetate

    Solubility






    Alexotech has developed a proprietary technique of preparing the amyloid β-peptide (1-40) having a superior solubility. It is however, of utmost importance to follow our recommendations of solubilisation: To efficiently solubilise the amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice.

    Storage

    Store at -20°C upon arrival.

    Source

    Protein expressed in Escherichia coli using 15NH4-Cl as sole nitrogen source.

    Product Citations




















    Olofsson, A., Lindhagen-Persson, M., Vestling, M., Sauer-Eriksson, A. E., & Öhman, A. (2009). Quenched hydrogen/deuterium exchange NMR characterization of amyloid-β peptide aggregates formed in the presence of Cu2+or Zn2+. FEBS Journal, 276(15), 4051–4060. https://doi.org/10.1111/j.1742-4658.2009.07113.x

    Brännström, K., Öhman, A., & Olofsson, A. (2011). Aβ Peptide Fibrillar Architectures Controlled by Conformational Constraints of the Monomer. PLoS ONE, 6(9), e25157. https://doi.org/10.1371/journal.pone.0025157

    Lindgren, J., Wahlström, A., Danielsson, J., Markova, N., Ekblad, C., Gräslund, A., … Wärmländer, S. K. (2010). N-terminal engineering of amyloid-β-binding Affibody molecules yields improved chemical synthesis and higher binding affinity. Protein science : a publication of the Protein Society, 19(12), 2319–2329. doi:10.1002/pro.511

    Wallin, C., Kulkarni, Y. S., Abelein, A., Jarvet, J., Liao, Q., Strodel, B., … Wärmländer, S. K. T. S. (2016). Characterization of Mn(II) ion binding to the amyloid-β peptide in Alzheimer⿿s disease. Journal of Trace Elements in Medicine and Biology, 38, 183–193. https://doi.org/10.1016/j.jtemb.2016.03.009

    Luo, J., Wärmländer, S. K. T. S., Gräslund, A., & Abrahams, J. P. (2014). Non-chaperone Proteins Can Inhibit Aggregation and Cytotoxicity of Alzheimer Amyloid β Peptide. Journal of Biological Chemistry, 289(40), 27766–27775. https://doi.org/10.1074/jbc.m114.574947