Description
Article no.: ABNC-100-05
|
Description |
Recombinant Amyloid-Beta-Peptide (1-40) uniformly 13C,15N labeled |
|
Amount |
0.5mg |
|
Format |
Lyophilized |
|
Sequence |
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
|
Purity |
95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Acetate |
|
Solubility |
Alexotech has developed a proprietary technique of preparing the amyloid β-peptide (1-40) having a superior solubility. It is however, of utmost importance to follow our recommendations of solubilisation: To efficiently solubilise the amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli using 15NH4-Cl as sole nitrogen source and 13C glucose as sole carbon source. |