Description
Article no.: AS-600-500
|
Description |
Bulk order of Recombinant Alpha-Synuclein Protein. The protein is delivered in fifty 1mg vials. |
|
Amount |
50*1mg |
|
Format |
Lyophilized |
|
Molecular Weight |
14460 Da |
|
Sequence |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVAT |
|
Purity |
95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Carbonate |
|
Solubility |
Alpha-Synuclein is readily soluble in PBS |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli. |
|
Product Citations |