Description
Article no.: ASNC-600-05
|
Description |
Recombinant 13C, 15N-Alpha-Synuclein Protein |
|
Amount |
0.5mg |
|
Format |
Lyophilized |
|
Sequence |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVAT |
|
Purity |
95% by Chromatography and SDS-PAGE |
|
Counter Ion |
Ammonium Carbonate |
|
Solubility |
Alpha-Synuclein is readily soluble in PBS. |
|
Storage |
Store at -20°C upon arrival. |
|
Source |
Protein expressed in Escherichia coli in minimal media using 15NH4Cl as sole nitrogen source and 13C-glucose as sole carbon source. |