0
Your cart
Amyloid-Beta 1-40 (0.2 mg) Human, Synthetic

Amyloid-Beta 1-40 (0.2 mg) Human, Synthetic

$105
Read more...

    Description

    Article no.: AB-150-02

    Description

    Synthetic Amyloid-Beta-peptide 1-40

    Amount

    0.2mg

    Format

    Lyophilized

    Molecular Weight

    4330 Da

    Sequence

    DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Purity

    95% HPLC and SDS-PAGE

    Counter Ion

    TFA (Trifluoracetic Acid)

    Solubility





    Alexotech has developed a proprietary technique of preparing the Amyloid β-peptide (1-40) having a superior solubility. It is however, of utmost importance to follow our recommendations of solubilisation: To efficiently solubilise the Amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice.

    Storage

    Store at -20°C upon arrival.

    Product Citations














    Olofsson, A., Lindhagen-Persson, M., Vestling, M., Sauer-Eriksson, A. E., & Öhman, A. (2009). Quenched hydrogen/deuterium exchange NMR characterization of amyloid-β peptide aggregates formed in the presence of Cu2+or Zn2+. FEBS Journal, 276(15), 4051–4060. https://doi.org/10.1111/j.1742-4658.2009.07113.x

    Lindhagen-Persson, M., Brännström, K., Vestling, M., Steinitz, M., & Olofsson, A. (2010). Amyloid-β Oligomer Specificity Mediated by the IgM Isotype – Implications for a Specific Protective Mechanism Exerted by Endogenous Auto-Antibodies. PLoS ONE, 5(11), e13928. https://doi.org/10.1371/journal.pone.0013928

    Brunetti, D., Torsvik, J., Dallabona, C., Teixeira, P., Sztromwasser, P., Fernandez-Vizarra, E., … Bindoff, L. A. (2015). Defective PITRM1 mitochondrial peptidase is associated with A  amyloidotic neurodegeneration. EMBO Molecular Medicine, 8(3), 176–190. https://doi.org/10.15252/emmm.201505894

    Lindberg, D. J., Wranne, M. S., Gilbert Gatty, M., Westerlund, F., & Esbjörner, E. K. (2015). Steady-state and time-resolved Thioflavin-T fluorescence can report on morphological differences in amyloid fibrils formed by Aβ(1-40) and Aβ(1-42). Biochemical and Biophysical Research Communications, 458(2), 418–423. https://doi.org/10.1016/j.bbrc.2015.01.132