0
Your cart
Amyloid-Beta 1-40 (0.2 mg) Human, Recombinant

Amyloid-Beta 1-40 (0.2 mg) Human, Recombinant

$115
Read more...

    Description

    Article no.: AB-100-02

    Description

    Recombinant Amyloid-Beta-peptide 1-40

    Amount

    0.2mg

    Format

    Lyophilized

    Molecular Weight

    4330 Da

    Sequence

    DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Purity

    95% by Chromatography and SDS-PAGE

    Counter Ion

    Ammonium Acetate

    Solubility






    Alexotech has developed a proprietary technique of preparing the Amyloid β-peptide (1-40) having a superior solubility. It is however, of utmost importance to follow our recommendations of solubilisation: To efficiently solubilise the Amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice.

    Storage

    Store at -20°C upon arrival.

    Source

    Protein expressed in Escherichia coli.

    Product Citations



















    Lindberg, D. J., Wranne, M. S., Gilbert Gatty, M., Westerlund, F., & Esbjörner, E. K. (2015). Steady-state and time-resolved Thioflavin-T fluorescence can report on morphological differences in amyloid fibrils formed by Aβ(1-40) and Aβ(1-42). Biochemical and Biophysical Research Communications, 458(2), 418–423. https://doi.org/10.1016/j.bbrc.2015.01.132 

    Horowitz, S., Koepnick, B., Martin, R., Tymieniecki, A., Winburn, A. A., Cooper, S., … Bardwell, J. C. (2016). Determining crystal structures through crowdsourcing and coursework. Nature communications, 7, 12549. doi:10.1038/ncomms12549

    Luo, J., Wärmländer, S. K., Gräslund, A., & Abrahams, J. P. (2014). Non-chaperone proteins can inhibit aggregation and cytotoxicity of Alzheimer amyloid β peptide. The Journal of biological chemistry, 289(40), 27766–27775. doi:10.1074/jbc.M114.574947

    Lu, J.-X., Qiang, W., Yau, W.-M., Schwieters, C. D., Meredith, S. C., & Tycko, R. (2013). Molecular Structure of β-Amyloid Fibrils in Alzheimer’s Disease Brain Tissue. Cell, 154(6), 1257–1268. https://doi.org/10.1016/j.cell.2013.08.035

    Schultz, N., Brännström, K., Byman, E., Moussaud, S., Nielsen, H. M., … Olofsson, A. (2018). Amyloid-beta 1-40 is associated with alterations in NG2+ pericyte population ex vivo and in vitro. Aging Cell, 17(3), e12728. https://doi.org/10.1111/acel.12728