Mouse IgG Anti-Transthyretin (39-44) (Amyloid Specific) 100 ug

Immunogen

Recombinant protein corresponding to the Human wild type Transthyretin.
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASG
KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTA
NDSGPRRYTIAALLSPYSYSTTAVVTNPKE

The epitope has been mapped to residue 39-44

Host

Mouse

Clonality

Monoclonal

Subclass/Isotype

IgG1

Purity

Affinity Purified

Format

Lyophilized

Quantity

100 µg

Reconstitution

Add 100 ul PBS to reconstitute to 1 mg/ml 

Storage

Store lyophilized/reconstituted at 4°C. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.

Tested applications

The antibody performs well in both ELISA, IHC and Western blot. Dry milk dissolved in TBS containing 0.3% Tween-20 provides agood blocking and incubation solution. Washing can preferably be performed using TBS containing 0.3% tween-20. 

Recommended dilution

1:1000 (ELISA), 1:1000 (Western Blot) 1:500 (IHC)

Expected | apparent MW

155 kDa

Confirmed Reactivity

Human Transthyretin Amyloids only

Predicted Reactivity

No confirmed exceptions from predicted reactivity are currently known.

Not reactive in

No confirmed exceptions from predicted reactivity are currently known.

Application Examples

Western analysis
Membrane: PVDF
Blocking buffer: 1% dry milk in TBS, 0.3% Tween 20
Antibody dilution : 1:1000
Secondary antibody: anti-mouse (HRP)
Detection: Enhanced Chemoluminescence (pico)   150s

Additional information

Specifically reactive to the amyloid form of Human transthyretin. Epitope mapped to residue 39-44 which remains burried within the native fold of transthyretin but becomes exposed within its amyloid form.

It has been suggested that that two distinct mechanisms of TTR-amyloidosis exists. The first, most common seen in wild type TTR Amyloidosis, consists of the full length TTR. Whereas the other type of amyloidosis mainly consists of the C-terminal region of the protein and is more common in mutant versions of TTR. Mouse IgG1 Anti-Transthyretin 39-44 (Amyloid Specific) epitope is located at the N-terminal strand of cleaved TTR and is suitable to detect amyloid formation derived from full length TTR.

Related products

Mouse IgG Anti-Transthyretin 56-61 (Amyloid Specific)
AT-560-100

Background

Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.

Selected references

Goldsteins, G et al. “Exposure of cryptic epitopes on transthyretin only in amyloid and in amyloidogenic mutants” Proceedings of the National Academy of Sciences of the United States of America vol. 96,6 (1999): 3108-13